PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma18g01210.1
Common NameZOSMA_18G01210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 293aa    MW: 32802.9 Da    PI: 5.279
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma18g01210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.6e-092192512355
                      SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ee+ +L + +gL+ +q+ +WF N R ++
  Zosma18g01210.1 219 PYPTEEEKIKLGEMTGLEPKQINNWFINERKRH 251
                      8*****************************885 PP

2ELK30.76.9e-11171192122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK  Ll+KYsgyLg+L++EF+
  Zosma18g01210.1 171 ELKAVLLKKYSGYLGTLRKEFL 192
                      89999****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-182165IPR005540KNOX1
PfamPF037901.8E-192363IPR005540KNOX1
SMARTSM012569.5E-2270121IPR005541KNOX2
PfamPF037911.7E-2273120IPR005541KNOX2
SMARTSM011883.6E-6171192IPR005539ELK domain
PROSITE profilePS5121310.598171191IPR005539ELK domain
PfamPF037896.6E-9171192IPR005539ELK domain
PROSITE profilePS5007111.936191254IPR001356Homeobox domain
SuperFamilySSF466898.55E-19193264IPR009057Homeodomain-like
SMARTSM003896.4E-12193258IPR001356Homeobox domain
CDDcd000862.68E-12194255No hitNo description
Gene3DG3DSA:1.10.10.602.0E-25196257IPR009057Homeodomain-like
PfamPF059207.1E-16211250IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEDLYSIHPA IPRSAQSDLS DLIKAQIASH PLYPSLVSAY IDCRKVGAPP ETASVLEDIV  60
KERSSVPICS HREIGSDPEL DEFMESYFQV LIRFKEELSK PFEEATTFLT KMEMQLGDLC  120
QTKTSNSTIT NAVCNSPSDW GSSEGEEMSC GETDRTESQE EYYSLKSGNH ELKAVLLKKY  180
SGYLGTLRKE FLKKRKKGML PKDSKLILLD WWNTHYRWPY PTEEEKIKLG EMTGLEPKQI  240
NNWFINERKR HWKPSQDMRF ALIDGVSSGG NGGGGDGGGG GTLHFDTGTF GP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186195LRKEFLKKRK
2192196KKRKK
3267281SGGNGGGGDGGGGGT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781110.11e-118PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-102KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0K9PPL90.0A0A0K9PPL9_Z
STRINGSb03g012480.11e-111(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-74KNOTTED1-like homeobox gene 6